Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: d1ogqa_

Fold library idFoldSuperfamilyFamily
d1ogqa_Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)L domain-likePolygalacturonase inhibiting protein PGIP


Added to library: Tue Mar 16 13:08:41 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ELCNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPS
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

S
TT

GGGTT

TTS
TTTT
STT

SSS






SS


G
 .........80.........90.........100.........110.........120.........130.........140
Sequence SLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGT
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP) GGGG
TT
STTS


GGGGG
TT
S



GGGGG
TT



SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLE
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)

GGGGG
TT



SS



GGGG


TT



SS

GGGGG


S

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence GDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNL
Predicted secondary structure






























































SS confidence





































































Known secondary structure (DSSP)

GGG

TTS

S

SS

BGGG



TT



SS




GGGGG
TT



SS
 .........290.........300.........310...
Sequence CGEIPQGGNLQRFDVSAYANNKCLCGSPLPACT
Predicted secondary structure



























SS confidence
































Known secondary structure (DSSP)


STTGGGS
GGGT
SSSSTTSS



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D