Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: d1no7a_

Fold library idFoldSuperfamilyFamily
d1no7a_Major capsid protein VP5Major capsid protein VP5Major capsid protein VP5


Added to library: Tue Mar 16 13:54:40 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ANPYGAYVAAPAGPAADMQQLFLNAWGQRLAHGRVRWVAALELHPAFDFFVGVADVELPGGDVPPAGPGE
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)


GGG





S
TTSSS

SS






TT



SS

TT

SS


S


 .........80.........90.........100.........110.........120.........130.........140
Sequence IQATWRVVNGNLPLALCPAAFRDARGLELGVGRHAMAPATIAAVRGAFDDRNYPAVFYLLQAAIHGSEHV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)



SGGGS
TTTS
TTS




TT

TS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence FCALARLVVQCITSYWNNTRCAAFVNDYSLVSYVVTYLGGDLPEECMAVYRDLVAHVEALAQLVDDFTLT
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) TSS

SSTT
S
GGGS
TS
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence GPELGGQAQAELNHLMRDPALLPPLVWDCDALMRRAALDRHRDCRVSAGGHDPVYAAACNVATADFNRND
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)


GGGS
BSTT
TTS

SB
SSSSS
TTT



TTB

S


SSS

TT

S
 .........290.........300.........310.........320.........330.........340.........350
Sequence GQLLHNTQARAADAADDRPHRGADWTVHHKIYYYVMVPAFSRGRCCTAGVRFDRVYATLQNMVVPEIAPG
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)




SSSSS

SSS
SS
TTT


T







TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence EECPSDPVTDPAHPLHPANLVANTVNAMFHNGRVVVDGPAMLTLQVLAHNMAERTTALLCSAAPDAGANT
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) S




TTT
TTSTTSGGG

TTSTT



GGGGGGTS







SS
SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence ANMRIFDGALHAGILLMAPQHLDHTIQNGDYFYPLPVHALFAGADHVANAPNFPPALRDLSRQVPLVPPA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)



SS
S


TTSTTTTTSS

SBTTBB
TSTT

TTTTSS



GG
 .........500.........510.........520.........530.........540..
Sequence LGANYFSSIRQPVVQHVRESAAGENALTYALMAGYFKISPVALHHQLKTGLH
Predicted secondary structure










SS confidence



















































Known secondary structure (DSSP) G

GGGSSS




TB

ST


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D