Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: d1md6a_

Fold library idFoldSuperfamilyFamily
d1md6a_beta-TrefoilCytokineInterleukin-1 (IL-1)


Added to library: Tue Mar 16 12:59:21 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

SS
TT

BTT

TTS




TTS
GGG
TTTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence TEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPA
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) SSSS


S

SSS

GGG
SS
SSSTT
B
SSSS



SS

 .........150....
Sequence WDAPITDFYFQQCD
Predicted secondary structure





SS confidence













Known secondary structure (DSSP) TTS
B




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D