Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: d1lmqa_

Fold library idFoldSuperfamilyFamily
d1lmqa_Lysozyme-likeLysozyme-likeC-type lysozyme


Added to library: Tue Mar 16 12:06:36 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KVYDRCELARALKASGMDGYAGNSLPNWVCLSKWESSYNTQATNRNTDGSTDYGIFQINSRYWCDDGRTP
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
B

TT
TTBTTB
TTBTT

TTS
TTTTTTTS
B
S

T
 .........80.........90.........100.........110.........120.........
Sequence GAKNVCGIRCSQLLTDDLTVAIRCAKRVVLDPNGIGAWVAWRLHCQNQDLRSYVAGCGV
Predicted secondary structure





























SS confidence


























































Known secondary structure (DSSP) T


TT
SBGGGGSSSS
TTSTTGGGG
TTTS

GGGTTTS


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D