Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: d1l2ha_

Fold library idFoldSuperfamilyFamily
d1l2ha_beta-TrefoilCytokineInterleukin-1 (IL-1)


Added to library: Tue Mar 16 12:04:14 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVWSMSFVQGEESNKIPVALGLKEKNLYLSCVLK
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
TT

SSSS



GGGGGGS


SS




TTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence DDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNFYISTSQAENMPVFLGGQDITDFTM
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT

TTT
S
SS

GGG
TTSSSTT
BB
SSTT



SB

 ....
Sequence QFVS
Predicted secondary structure
SS confidence



Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D