Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: d1itua_

Fold library idFoldSuperfamilyFamily
d1itua_TIM beta/alpha-barrelMetallo-dependent hydrolasesRenal dipeptidase


Added to library: Tue Mar 16 12:11:01 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTP
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
TTS

TT
TTSGGG
TTT

SSS

TT


 .........80.........90.........100.........110.........120.........130.........140
Sequence CDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRAL
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) GGGTTTT
TTT

ST

GGGGTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence YQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTS
SSS

SSB
BGGGGGTSS

SSSSB
T

TTB
 .........220.........230.........240.........250.........260.........270.........280
Sequence SRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
SS

SS

BTTTS

TTSB
T



TSSS

B
G
 .........290.........300.........310.........320.........330.........340.........350
Sequence RAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) GG


TTS
S


BT
SSTT
TT

T

SSS




 .........360.........
Sequence PIPLDQLGGSCRTHYGYSS
Predicted secondary structure















SS confidence


















Known secondary structure (DSSP)


GGG

SSS


TTT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D