Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: d1ihma_

Fold library idFoldSuperfamilyFamily
d1ihma_Nucleoplasmin-like/VP (viral coat and capsid proteins)Positive stranded ssRNA virusesCaliciviridae-like VP


Added to library: Tue Mar 16 13:16:29 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DPLAMDPVAGSSTAVATAGQVNPIDPWIINNFVQAPQGEFTISPNNTPGDVLFDLSLGPHLNPFLLHLSQ
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)


S





TTSGGGTSS

B


TTTTT


TTS
TT

SGGGST
 .........80.........90.........100.........110.........120.........130.........140
Sequence MYNGWVGNMRVRIMLAGNAFTAGKIIVSCIPPGFGSHNLTIAQATLFPHVIADVRTLDPIEVPLEDVRNV
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TBS



SS

TTS





TTSSTT
SS




SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LFHNNDRNQQTMRLVCMLYTPLRTGGGTGDSFVVAGRVMTCPSPDFNFLFLVPPTVEQKTRPFTLPNLPL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) S
S
TTS



S


SS

TT


TT


B

TTT
STT








G
 .........220.........230.........240.........250.........260.........270.........280
Sequence SSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTP
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) GG
B
SSSS
B



TT


B

SSS
B
TTS
B
TT

SSGGGTTSS
TTS
B
 .........290.........300.........310.........320.........330.........340.........350
Sequence FHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISP
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)

TTT
SSSTT




B

TTS




S
STT
BGGGT
TT


 .........360.........370.........380.........390.........400.........410.........420
Sequence PSHPSGSQVDLWKIPNYGSSITEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASE
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
STTTS


BTTS






TTS






B


STT

SSS
SS
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence QAPTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGASSGPQQLPINGVFVFVSWVSRFYQLKPVGT
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)




SS
TTT

TTT
BSSTT
SGGGS
TT

TT




BS
 ..
Sequence AS
Predicted secondary structure

SS confidence

Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D