Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: d1h6ua2

Fold library idFoldSuperfamilyFamily
d1h6ua2Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)L domain-likeInternalin LRR domain


Added to library: Tue Mar 16 14:07:19 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GSITQPTAINVIFPDPALANAIKIAAGKSNVTDTVTQADLDGITTLSAFGTGVTTIEGVQYLNNLIGLEL
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)



S


STT
SSTTS
T


TTS




TTGGG
TT


 .........80.........90.........100.........110.........120.........130.........140
Sequence KDNQITDLAPLKNLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLAGLSNLQVLYLDLNQ
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
SS




GGGTT

S



S


S

GGGTT
TT


TTS




GGGTT
TT



SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence ITNISPLAGLTNLQYLSIGNAQVSDLTPLANLSKLTTLKADDNKISDISPLASLPNLIEVHLKNNQISDV
Predicted secondary structure






























































SS confidence





































































Known secondary structure (DSSP)



GGGGG
TT



SS




GGGTT
TT



SS




GGGGG
TT


TTS




 .........220.......
Sequence SPLANTSNLFIVTLTNQ
Predicted secondary structure











SS confidence
















Known secondary structure (DSSP) GGGTT
TT






Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D