Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7k47A_

Fold library idPDB HeaderMoleculeTitle
c7k47A_2.90PDB header: transferaseChain: A: PDB Molecule: bifunctional protein glmu;


Added to library: Sat Sep 26 08:56:17 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HHMTQPLHVIILAAGAGKRMKSVLPKVLQPIAGQPMLAHVIDAARELQPAAIHVVHGHGGEAVRQYFAGQ
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)









GGG
SSS
GGGSBSSSSBTT

S
TTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence PDLQWAEQAQQLGTGHAVAQAMPQVPDLAQVLVLYGDVPLIRAQTLRDLLAQPGRLAVLVADVDDPTGYG
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT


S


GGGS
TT
TT
TT

T

SS
S

TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence RVLRDAEGKVGAIIEQKDATDDQLRVRTINTGIIAAESTALRRWLSQLSNSNAQGEYYLTDVFAFAAHEY
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) GGG
STT

TTGGG





SSS



GGGTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence TPAEMALVADAQEAEGANDPWQLSQLERAWQRRAVRALCAQGARVRDPARLDIRGTVTVGSDVLIDVDVV
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

B
SSGGGG



STT
S
GGGSS
SS

SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence LEGKVVLGDGVTVGPFNRLKDVNLGPGTDVRAHCDLEGVVTEGAAQIGPFARLRPGTVLADGVHVGNFVE
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)
TT

SS
TT

SSSS


SS
TT
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence TKKVTLGVGSKANHLTYLGDAVIGSKVNIGAGTITCNYDGVNKSTTTIGDNAFIGSNSSLVAPVTIGDGA
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
TT

SS

TT

BSSS
B


TT

TT
SS
TT
 .........430.........440.........450.....
Sequence TIAAGSVITRNAPDGKLTLARARQETIDGWKRPLK
Predicted secondary structure

























SS confidence


































Known secondary structure (DSSP)
TT

S
B
TTS








SS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D