Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7d7qB_

Fold library idPDB HeaderMoleculeTitle
c7d7qB_3.50PDB header: membrane proteinChain: B: PDB Molecule: phosphodiesterase;


Added to library: Sat Nov 21 08:35:10 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IAIASTKEVQWQGIFMIIVWLCVMGSLIFFANPEASRRVFAKFSHLQSFYGATSVAFAFATGLDILAYVN
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP)




T

STTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AVSDEKRVLSGILAYVDGVACISYLSMATLNLYFLVDSTQGNPVWLMRYAEWIITCPTLLYWCGLASRAD
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
SSSS




TTTS

SS


 .........150.........160.........170.........180.........190.........200.........210
Sequence RSSVSDIATADALLLAGGALSSILPSWPAFFVFAGSFATYIYVMLHMWGMFGKAMQPDFQPPPPLPRHAL
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TTSSS
TTSSSS
SS

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence HLLRCEIVMSWSIFPLVEFLRRQGYIDFQVGEAMNCVADYAAKVGLAMIMVNCNLEQINALRVQQMHSAL
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) TTSS
 .........290.........300.........310
Sequence TGMLKVMRKTNLSSSRMAQLDGVDDDVKSW
Predicted secondary structure





SS confidence





























Known secondary structure (DSSP) TT


SS

SSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D