Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7cgvD_

Fold library idPDB HeaderMoleculeTitle
c7cgvD_2.38PDB header: oxidoreductaseChain: D: PDB Molecule: artificial l-threonine 3-dehydrogenase;


Added to library: Sat Oct 31 09:39:46 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KRILVIGANGQIGSELVPALRKRYGADNVIASDIRPPNLYEAGPFEYLDVLDKEALAELVKKYKITQIYH
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

STTS
GGGSS

SS

SS


TT
T

 .........80.........90.........100.........110.........120.........130.........140
Sequence LAALLSQKAWDLNMDGLLNVLEIARERGPLKVFWPSSIAAFGPNTPKDNTPQDTIMRPTTIYGISKVAGE
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP)






TTTSSS



GGG

TTS
SSSB
SS




SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LLCEYYHTKYGVDVRSVRYPGIISYKTPPGGGTTDYAVEIFYEALKGGKYECFLGPDTTLPMMYMPDAIR
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TS



SSS


SSGGGTTTSSS
TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence ATIELMEAPAEKLKHRSSYNVAAMSFTPEELAAEIKKHIPDFEITYKPDVRQAIADSWPKSLDDSAARAD
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S
GGG
TT
S

S

TT



TTS
S
B

 .........290.........300...
Sequence WGWKPRYDLEEMTKDMLENLDVK
Predicted secondary structure









SS confidence






















Known secondary structure (DSSP) S











Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D