Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7cbbA_

Fold library idPDB HeaderMoleculeTitle
c7cbbA_2.60PDB header: biosynthetic proteinChain: A: PDB Molecule: iuca/iucc family siderophore biosynthesis protein;


Added to library: Sat Sep 26 09:06:36 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QNHTAVNTAQAIILRDLVDALLFEDIAGIVSNSEITKENGQTLLIYERETQQIKIPVYFSALNXFRYESS
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

TGGGTTTTSTTTT
TTSS
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence QPITIEGRVSKQPLTAAEFWQTIANXNCDLSHEWEVARVEEGLTTAATQLAKQLSELDLASHPFVXSEQF
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) S

TT



S


T
TTS
T



SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence ASLKDRPFHPLAKEKRGLREADYQVYQAELNQSFPLXVAAVKKTHXIHGDTANIDELENLTVPIKEQATD
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
STT
TTTT
T


GGG


TTS
TT

GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence XLNDQGLSIDDYVLFPVHPWQYQHILPNVFATEISEKLVVLLPLKFGDYLSSSSXRSLIDIGAPYNHVKV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTT

GGG
TTTTS
SSSSTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence PFAXQSLGALRLTPTRYXKNGEQAEQLLRQLIEKDEALAKYVXVCDETAWWSYXGQDNDIFKDQLGHLTV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)



TT





B




TT

TT
GGGGGS
 .........360.........370.........380.........390.........400.........410.........420
Sequence QLRKYPEVLAKNDTQQLVSXAALAANDRTLYQXICGKDNISKNDVXTLFEDIAQVFLKVTLSFXQYGALP
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)

T
SSSTTGGGSS
ST
S


TTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence ELHGQNILLSFEDGRVQKCVLRDHDTVRIYKPWLTAHQLSLPKYVVREDTPNTLINEDLETFFAYFQTLA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

STTTTT

GGG

TT








TTS

SSB
SST
 .........500.........510.........520.........530.........540.........550.........560
Sequence VSVNLYAIIDAIQDLFGVSEHELXSLLKQILKNEVATISWVTTDQLAVRHILFDKQTWPFKQILLPLLYQ
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTT


S


TTTTTSS
S
 .........570......
Sequence RXPSGLTTVPNPXVTY
Predicted secondary structure











SS confidence















Known secondary structure (DSSP)





TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D