Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7c1yB_

Fold library idPDB HeaderMoleculeTitle
c7c1yB_2.08PDB header: rnaChain: B: PDB Molecule: pfkb-like carbohydrate kinase family protein;


Added to library: Sat Nov 21 08:59:17 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MEPVIIGALILDVHAKPSTTPISGTTVPGQVLFAPGGVARNVADCIFKLGITPFMIGTLGLDGPANVLLK
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


S

SS


TTS



TT


SST
 .........80.........90.........100.........110.........120.........130.........140
Sequence EWKLSMKGILRREDISTPIVSLVYDTNGEVAAGVAGVDAVENFLTPEWIQRFEYNISSARLLMVDANLSS
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) T

S

TTTT




TTSS
TS
TT
S
TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LALEASCKLAAESSVPVWFEPVSVTKSQRIASIAKYVTIVSPNQDELIAMANALCAKNLFHPFRENKLSI
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTT



STTGGGGGGGTGGG
S

BSSS











 .........220.........230.........240.........250.........260.........270.........280
Sequence EDMFRALKPAILVLLKNGVKVVIVTLGSNGALLCSKGNPKKALNIDRVQSVCSPSLFAMHFPTIPAKVKK
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT
S
GGG
S
S



S



TTTS









S
 .........290.........300.........310.........320.........330.........340.......
Sequence LTGAGDCLVGGTVASLSDGLDLIQSLAVGIASAKAAVESDDNVPPEFKLDLISGDAELVYNGAKMLM
Predicted secondary structure























SS confidence


































































Known secondary structure (DSSP)
TTTT

TSSSSS
S


T



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D