Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7c11O_

Fold library idPDB HeaderMoleculeTitle
c7c11O_2.82PDB header: ligaseChain: O: PDB Molecule: formate-tetrahydrofolate ligase;


Added to library: Sat Oct 31 08:35:20 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PSDIEIARAATLKPIAQVAEKLGIPDEALHNYGKHIAKIDHDFIASLEGKPEGKLVLVTAISPTPAGEGK
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

S




TT

GGGTTT
TT
SSS


SS

TT



 .........80.........90.........100.........110.........120.........130.........140
Sequence TTTTVGLGDALNRIGKRAVMCLREPSLGPCFGMKGGAAGGGKAQVVPMEQINLHFTGDFHAITSAHSLAA
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTS





TGGGGTS



SSBTTB

TTTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence ALIDNHIYWANELNIDVRRIHWRRVVDMNDRALRAINQSLGGVANGFPREDGFDITVASEVMAVFCLAKN
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT
TT



SS

GGGSSS
SSGGG



GGGSTT
SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LADLEERLGRIVIAETRDRKPVTLADVKATGAMTVLLKDALQPNLVQTLEGNPALIHGGPFANIAHGCNS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT
TTS
TTTTT
TGGGS
SS






SSSS




 .........290.........300.........310.........320.........330.........340.........350
Sequence VIATRTGLRLADYTVTEAGFGADLGAEKFIDIKCRQTGLKPSSVVIVATIRALKMHGGVNKKDLQAENLD
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TS
S
TT
TTTT



S
TTT

TT
SSS

 .........360.........370.........380.........390.........400.........410.........420
Sequence ALEKGFANLERHVNNVRSFGLPVVVGVNHFFQDTDAEHARLKELCRDRLQVEAITCKHWAEGGAGAEALA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTTT



TT

SS



GGGGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence QAVVKLAEGEQKPLTFAYETETKITDKIKAIATKLYGAADIQIESKAATKLAGFEKDGYGKLPVCMAKTQ
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTS






SS
TTS
TS

S
T
TTS
S
S
 .........500.........510.........520.........530.........540.........550......
Sequence YSFSTDPTLMGAPSGHLVSVRDVRLSAGAGFVVVICGEIMTMPGLPKVPAADTIRLDANGQIDGLF
Predicted secondary structure




































SS confidence

































































Known secondary structure (DSSP) S
SSSSTT

SS

S

TTTT
S


SS



SS
GGGG

SS

S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D