Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7bzcA_

Fold library idPDB HeaderMoleculeTitle
c7bzcA_2.30PDB header: lyaseChain: A: PDB Molecule: terpenoid synthase 18;


Added to library: Sat Sep 26 09:47:04 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLWGDHFLSVSLDRGEFDELEREIETMKPLVKDMLMSSQSSDKEKIRLIHLLVSLGSSYHFDKEIQDILK
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
TT




SSS
TT
GGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence HSFTKLDDIIVGEDDLETISIMFEVFRLYGHKMSCDAFDRFRGEDGRFKESLAKDVRGMLQLFEVAHLGT
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TTTT


TT



GGGGGGGB
SSSSB
GGGGG
TTS

 .........150.........160.........170.........180.........190.........200.........210
Sequence PSEDIMDEASSFAQNHLDSWIGGNVSGATPHLLKHIQNSLYIPRYCNIEVLVAREYISYYEQEEGHNKIL
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT
SSSGGGSS
GGGS
TSTT

 .........220.........230.........240.........250.........260.........270.........280
Sequence LKFAKLNFNFCQFHYIQELKTLTKWWKDLDLASKLPYIRDRLVESHLGGLGPYFEPHYSLGRIIVAKIIM
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) T
S




TT

SGGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence TMVVVDDTYDAHATVPEVAVLTECLQRLNIGADDKLPDYLRTVLESVFEVMGEIEQEMRPKGRSYGVKQV
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) S
TTS
TS


SS


TTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence LERFKNVAKADKQLTEWARTGDVPSFDEYMKVGLVTAGMDGYAGYCFIGMEDVSEKEAFEWLSSNPLIIQ
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) T




T
TTS
T

 .........430.........440.........450.........460.........470.........480.........490
Sequence ALNVMFRLANDVGTYETEINRGEVANGLNCYMKQYGVTKEEASQELRKIYSNNKKVVMEEFMNSHDHVPR
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TT


S


TBTTB
 .........500.........510.........520.........530.....
Sequence QVLLRCLNFARLFDVMYTEGDGYSEPKGKIEHFMTSLYVHPIPLS
Predicted secondary structure















SS confidence












































Known secondary structure (DSSP) TT

T






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D