Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7bwmA_

Fold library idPDB HeaderMoleculeTitle
c7bwmA_2.90PDB header: structural proteinChain: A: PDB Molecule: adhesin p1;


Added to library: Sat Oct 31 08:44:34 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NAINPRLTPWTYRNTSFSSLPLTGENPGAWALVRDNSAKGITSQQTTYDPTRTEAALTASTTFALRRYDL
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)

S
TT


BTTTTB

TTS

TT














T
 .........80.........90.........100.........110.........120.........130.........140
Sequence AGRALYDLDFSKLNPQTPTRDQTGQITFNPFGGFGLSGAAPQQWNEVKNKVPVEVAQDPSNPYRFAVLLV
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TS

TTT




B
B
TT

B
TTT
B
S


TTTTSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence PRSVVYYEQLQRGLGLPQQRTESGSTTGAMFGLKVKNAEADTAKSNEKLQGAEATSTQRGGGDTKVKALK
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP)
TGGGT








S





TT

TT






GGGGGGS




TTS



S


 .........220.........230.........240.........250.........260.........270.........280
Sequence IEVKKKSDSGQLQLEKNDLANAPIKRSEESGQSVQLKADDFGTALSPTPWRPWLATEQIHKDLPKWSASI
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

S



STTSGGG

S

TT



GGGG










SS
TS
 .........290.........300.........310.........320.........330.........340.........350
Sequence LILYDAPYARNRTAIDRVDHLDPKAMTANYPPSWRTPKWNHHGLWDWKARDVLLQTTGFFNPRRHPEWFD
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)
TTSSB


TSS
GGGGSTT

TTTT


SSS
TTT
GGG
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence GGQTVADNEKTGFDVDNSENTKQGFQKEADSDKSAPIALPFEAYFANIGNLTWFGQALLVFGGNGHVTKS
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) TTTTT
SS


SB

S
SSTTTTT
B


STT







T


TT



STTT

 .........430.........440.........450.........460.........470.........480.........490
Sequence AHTAPLSIGVFRVRYNATGTSATVTGWPYALLFSGMVNKQTDGLKDLPFNNNRWFEYVPRMAVAGAKFVG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TT



B

TTS

TTT

STT
SS
SS
S



TT





T
 .........500.........510.........520.........530.........540.........550.........560
Sequence RELVLAGTITMGDTATVPRLLYDELESNLNLVAQGQGLLREDLQLFTPYGWANRPDLPIGAWSSSSSSSH
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) T

B

TT
S
B
TT
GGG
TT
S


S
B

GGGBBS
S


GGGSS
SSS
SS
 .........570.........580.........590.........600.........610.........620.........630
Sequence NAPYYFHNNPDWQDRPIQNVVDAFIKPWEDKNGKDDAKYIYPYRYSGMWAWQVYNWSNKLTDQPLSADFV
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
TTTS
B

GGG




TTTTTTSTTTTT
S





S



SSTT

S

 .........640.........650.........660.........670.........680.........690.........700
Sequence NENAYQPNSLFAAILNPELLAALPDKVKYGKENEFAANEYERFNQKLTVAPTQGTNWSHFSPTLSRFSTG
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

B
SS


TTS
SS



GGGS

SSS

S




TT

GGGSGGG
S
 .........710.........720.........730.........740.........750.........760.........770
Sequence FNLVGSVLDQVLDYVPWIGNGYRYGNNHRGVDDITAPRSFLPTFSNIGVGLKANVQATLNLQLWTGAGWR
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)



SB
TTTS
BTTTT

GGGSSS






SS

TTSS



S






SSB
 .........780.........790.........800.........810.........820.........830.........840
Sequence NDKASSGQSDENHTKFTSATGMDTSAGNPDSLKQDNISKSGDSLTTQDGNAIDQQEATNYTNLPPNLTPT
Predicted secondary structure
































































SS confidence





































































Known secondary structure (DSSP)

B
SSSSSB
SSS




TT
TT




B

TTS


S

S

SSSS

BSS
S
SB
STT
 .........850.........860.........870.........880.........890.........900.........910
Sequence ADWPNALSFTNKNNAQRAQLFLRGLLGSIPVLVNRSGSDSNKFQATDQKWSYTDLHSDQTKLNLPAYGEV
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)


TT
GGG



T



B

STT



GGG



TT
STTS



SSSB
 .........920.........930.........940.........950.........960.........970.........980
Sequence NGLLNPALVETYFGNTRAGGSGSNTTSSPGIGFKIPEQNNDSKATLITPGLAWTPQDVGNLVVSGTTVSF
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) TTS

STTTTT
SGGGS
S


B




TT








TT
B


TT
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence QLGGWLVTFTDFVKPRAGYLGLQLTGLDASDATQRALIWAPRPWAAFRGSWVNRLGRVESVWDLKGVWAD
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TT
SSSS

TTB



TTST
SSTTTT
SSS
T
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence QAQSDSQGSTTTATRNALPEHPNALAFQVSVVEASAYKPNSTNSSPYLHLVKPKKVTQSDKLDDDLKNLL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) T

S
SS





S
TT





GGGGS






TTSS







TTS


GGG
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence DPNQVRTKLRQSFGTDHSTQPQPQSLKTTTPVFGTSSGNLSSVLSLSPVEKVSGWLVGQLPTNNLAPNTN
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) ST





SS

S




TTTTB



T



SS



S
 .........1200.........1210.........
Sequence TGNDVVGVGRLSESNAAKMNDDVDGIVRT
Predicted secondary structure



















SS confidence




























Known secondary structure (DSSP)
S
TTTS

STTSS

S





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D