Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7bu0A_

Fold library idPDB HeaderMoleculeTitle
c7bu0A_2.43PDB header: hydrolaseChain: A: PDB Molecule: uncharacterized protein;


Added to library: Sat Nov 21 08:33:27 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VNMFNVDNSGKGNCLYYAYSISLMYYLRAKNNVKITEDIFNKLGLKEEDRARLRKLLSKDPDRAFTRDEI
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)




B



SS
S

TT

TS
TTS


 .........80.........90.........100.........110.........120.........130.........140
Sequence KTIIEPILGRATRDLAAEHTKVEFKSSPHDTPLFSSLHYAVEFGFKRSLQINESELTLLIDNDFSNPDYT
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) T
GGGSTT
GGGGG



S

 .........150.........160.........170.........180.........190.........200.........210
Sequence EAEIYKVSGLLDALQEYILTRTPSVIEEFNRQWENKKQELKEQSLTEKEIQVHQATILDNILRKETIDFL
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP) TSGGGGSTTTTTS


 .........220.........230.........240.........250.........260.........270.........280
Sequence LAENEKHLDEYREHLRREFVWGSEETLMVLHRAIQGERMVRNHEGRIEPVYDHEIILHVHRNGASPSYQA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) STT



T

TTS

SS


TTB

SS

 .........290.........300.........310.........320.........330.........340.........350
Sequence GSPEMILNNEGNVHWTSIIPDAIFTSKLTDKEEKLLDMLERMQSEYGSKELGVEKYSSISDWLSDLMKQI
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)


STTT

TTS


SS
TTTSB

SSS

B
 .........360.........370.........380.........390.........400.......
Sequence ELIKTSPTAVTKQKEIELFFQLLAKATPKLASEPALRMSLGTLFSNFLECIPALMVE
Predicted secondary structure








SS confidence
























































Known secondary structure (DSSP)

STSSSTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D