Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7aobC_

Fold library idPDB HeaderMoleculeTitle
c7aobC_2.12PDB header: oxidoreductaseChain: C: PDB Molecule: malate dehydrogenase;


Added to library: Sat Oct 31 08:33:20 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MKRPKVSIVGAGNTGAALAHWLAIKQVADIVLVDVVEGMPQGKALDLMQSAPVEGFDVVITGSNDYAATA
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)





STT


SSTTT




SSGGGGT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GSDVVVITAGAARKPGMSRDDLVNINTGIVREITAQVARYSPDAYLIVLTNPLDVMCYVAYKVSGFPKHR
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) T
S






TT


TT


SS


GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence VMGQSGILDSARFRTFIARELNVSFEDVHALVLGGHGDSMVPLPRYTHVGGIPVTQLLPKEKIDELVRRT
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)

T

GGG
SGGGTTGGGTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence RDGGAEIVRLLKTGSAFFAPGAAMAEMVEAILRDRKRVLPVSAYLEGEYGESGIFMGVPVVLGGNGIEKI
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TSSS


TT

SGGG
TT
 .........290.........300........
Sequence LEIELTDEERQAFARSAADVRQTLSKLD
Predicted secondary structure






SS confidence



























Known secondary structure (DSSP)








Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D