Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7a24z_

Fold library idPDB HeaderMoleculeTitle
c7a24z_3.80PDB header: membrane proteinChain: Z: PDB Molecule: b16.6;


Added to library: Sat Oct 31 08:57:11 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EDLHTVSNWSGTHEVQTRNFNQPENLADLEALVKESHEKKLRIRPVGSGLSPNGIGLSRSGMVNLALMDK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)


S

TTSSTTS


SS
TT













SSS
SS
SSS

 .........80.........90.........100.........110.........120.........130.........140
Sequence VLEVDKEKKRVTVQAGIRVQQLVDAIKDYGLTLQNFASIREQQIGGIIQVGAHGTGARLPPIDEQVISMK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTTTTTSBTT
SS

S
SSSBTT


S
SSS



 .........150.........160.........170.........180.........190.........200.........210
Sequence LVTPAKGTIELSREKDPELFHLARCGLGGLGVVAEVTLQCVARHELVEHTYVSNLQEIKKNHKKLLSANK
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
SSS
TTT
TTTSS




S
 .........220.........230.........240.........250.........260.........270.........280
Sequence HVKYLYIPYTDTVVVVTCNPVSKWSGPPKDKPKYTTDEAVQHVRDLYRESIVKYRVQDSGKKSPDSSEPD
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)


TT
S
TT
SS


SSSSTTTTTT




SS

SSS






TT



SSSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence IQELSFTELRDKLLALDPLNDVHVAKVNQAEAEFWKKSEGYRVGWSDEILGFDCGGQQWVSESCFPAGTL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
SSS
TTT
S
S
TTTS




SS


B



TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence ANPSMKDLEYIEELKKLIEKEAIPAPAPIEQRWTARSKSPISPAFSTSEDDIFSWVGIIMYLPTADPRQR
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S

SS

SS



TTTS

SS





B

SS
SSTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence KDITDEFFHYRHLTQKQLWDQFSAYEHWAKIEIPKDKEELEALQARIRKRFPVDAYNKARRELDPNRILS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SSS
TTTTT

SSS
SSS
TTT
STS


SS

S
 .........
Sequence NNMVEKLFP
Predicted secondary structure





SS confidence








Known secondary structure (DSSP)



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D