Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7a24T_

Fold library idPDB HeaderMoleculeTitle
c7a24T_3.80PDB header: membrane proteinChain: T: PDB Molecule: 39kda;


Added to library: Sat Oct 31 09:40:13 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFD
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)



SSSSSS


S

B

TT
SSSS

B


S
TTSGGGGTSSSSSSSB



 .........80.........90.........100.........110.........120.........130.........140
Sequence PRDEDSIKAVMAKANVVINLIGREYETRNFSFEDANHHIAEKLALVAKEHGGIMRYIQVSCLGASVSSPS
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) SS
TTTTSS
S



SS

SSS
STTTSTT



TT

TT
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence RMLRAKAAAEEAVLNALPEATIMRPATMIGTEDRILNPWSMFVKKYGFLPLIGGGTTKFQPVYVVDVAAA
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SSS




SSTT
SSSTTTTTTTTTTTGGG



 .........220.........230.........240.........250.........260.........270.........280
Sequence IVAALKDDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVKLPFPIAKAMAAPRDFMVNKVPFPLP
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) S
S
SSS
B




SS
TT



TSTT

TTT
TTS


 .........290.........300.........310.........320........
Sequence SPQIFNLDQINALTTDTLVSDNALKFQDLDLVPHKLKGYPVEFLIQYR
Predicted secondary structure





















SS confidence















































Known secondary structure (DSSP)

SS

S


S

SS

GGGGT




SSSGGGGGGGGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D