Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7a23V_

Fold library idPDB HeaderMoleculeTitle
c7a23V_3.70PDB header: membrane proteinChain: V: PDB Molecule: mwfe;


Added to library: Sat Oct 31 08:34:08 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.......
Sequence SLVWLEAMLPLGIIGGMLCIMGNSQYYIHKAYHGRPKHIGHDEWDVAMERRDKKVVE
Predicted secondary structure











SS confidence
























































Known secondary structure (DSSP)

TTTSSS


SS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D