Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7a23M_

Fold library idPDB HeaderMoleculeTitle
c7a23M_3.70PDB header: membrane proteinChain: M: PDB Molecule: nad4m;


Added to library: Sat Oct 31 08:59:56 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LSGLILCPVLGSIILLFIPNSRIRLIRLIGLCASLITFLYSLVLWIQFDSSTAKFQFVESLRWLPYENIN
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
TTTT
TT


SSTT

TT
SS
TT
B


SSTGGG

 .........80.........90.........100.........110.........120.........130.........140
Sequence FYLGIDGISLFFVILTTFLIPICILVGWSGMRSYGKEYIIAFLICEFLMIAVFCMLDLLLFYVFPESVLI
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP)

B


TTT

SS
TTTTTT

TB
ST
 .........150.........160.........170.........180.........190.........200.........210
Sequence PMFIIIGVWGSRQRKIKAAYQFFLYTLLGSLFMLLAILLILFQTGTTDLQILLTTEFSERRQIFLWIAFF
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) SS

SSSS


S


S



 .........220.........230.........240.........250.........260.........270.........280
Sequence ASFAVKVPMVPVHIWLPEAHVEAPTAGSVILAGILLKFGTYGFLRFSIPMFPEATLCFTPFIYTLSAIAI
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP) TT
TTS
TTS
TTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence IYTSLTTLRQIDLKKIIAYSSVAHMNLVTIGMFSPNIQGIGGSILLMLSHGLVSSALFLCVGVLYDRHKT
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) TTT


T
S
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence RLVRYYGGLVSTMPNFSTIFFSFTLANMSLPGTSSFIGEFLILVGAFQRNSLVATLAALGMILGAAYSLW
Predicted secondary structure

SS confidence





































































Known secondary structure (DSSP)

STT



TT
TTST
SSS
SSS
 .........430.........440.........450.........460.........470.........480..
Sequence LYNRVVSGNLKPDFLHKFSDLNGREVFIFIPFLVGLVWMGVYPKVFLDCMHTSVSNLVQHGK
Predicted secondary structure



















SS confidence





























































Known secondary structure (DSSP)
TT


SS
S






TTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D