Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7a23I_

Fold library idPDB HeaderMoleculeTitle
c7a23I_3.70PDB header: membrane proteinChain: I: PDB Molecule: nad2m;


Added to library: Sat Oct 31 09:05:54 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LAVFPEIFIINATFILLIHGVVFSTSKKYDYPPLASNVGWLGLLSVLITLLLLAAGAPLLTIAHLFWNNL
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP)


T
TTTTS


TTTTTTSTT
TTGGG

STTTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence FRRDNFTYFCQIFLLLSTAGTISMCFDFFDQERFDAFEFIVLILLSTCGMLFMISAYDLIAMYLAIELQS
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP) B


TTT


TTB
B
 .........150.........160.........170.........180.........190.........200.........210
Sequence LCFYVIAASKRKSEFSTEAGLKYLILGAFSSGILLFGCSMIYGSTGATHFDQLAKILTGYEITGARSSGI
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) S


SSS

BTTT

TTTS

 .........220.........230.........240.........250.........260.........270.........280
Sequence FMGILFIAVGFLFKITAVPFHMWAPDIYEGSPTPVTAFLSIAPKISIFANILRVFIYGSYGATLQQIFFF
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) TT
GGG
TTS
TTS

TTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence CSIASMILGALAAMAQTKVKRLLAYSSIGHVGYICIGFSCGTIEGIQSLLIGIFIYALMTMDAFAIVLAL
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP)

BSS
S
 .........360.........370.........380.........390.........400.........410.........420
Sequence RQTRVKYIADLGALAKTNPILAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLALVGVVTSVIG
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) TTS
S
BTTTTTSST
TTSTT
 .........430.........440.........450.........460.........470.........480.
Sequence CFYYIRLVKRMFFDTPRTWILYEPMDRNKSLLLAMTSFFITLFLLYPSPLFSVTHQMALSL
Predicted secondary structure

















SS confidence




























































Known secondary structure (DSSP) TS

TT







TSTT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D