Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7a23C_

Fold library idPDB HeaderMoleculeTitle
c7a23C_3.70PDB header: membrane proteinChain: C: PDB Molecule: 75kda;


Added to library: Sat Oct 31 08:44:47 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PTQILPPRNPVGGARVHFSNPEDAIEVFVDGYAVKVPKGFTVLQACEVAGVDIPRFCYHSRLSIAGNCRM
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)









TTS




S
TTS
TT
TT
BTTT




SS

SSS



S

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence CLVEVEKSPKPVASCAMPALPGMKIKTDTPIAKKAREGVMEFLLMNHPLDCPICDQGGECDLQDQSMAFG
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

BTT
SS
B
TTT
B

TT
SSSTTSS
S
TTT
TTSSS
TTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence SDRGRFTEMKRSVVDKNLGPLVKTVMTRCIQCTRCVRFASEVAGVQDLGILGRGSGEEIGTYVEKLMTSE
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)
SS



S










SS
TTT




TTS




SSGGG

SS





T
 .........220.........230.........240.........250.........260.........270.........280
Sequence LSGNVIDICPVGALTSKPFAFKARNWELKATETIDVSDAVGSNIRVDSRGPEVMRIIPRLNEDINEEWIS
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) TTTT
SSTTSTTSSS

TTT


B

SSTT

B
TT


BTTTBSS


 .........290.........300.........310.........320.........330.........340.........350
Sequence DKTRFCYDGLKRQRLSDPMIRDSDGRFKAVSWRDALAVVGDIIHQVKPDEIVGVAGQLSDAESMMVLKDF
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S
TTGGGSS


S

SSSS

TS
GGG

B
TT

 .........360.........370.........380.........390.........400.........410.........420
Sequence VNRMGSDNVWCEGTAAGVDADLRYSYLMNTSISGLENADLFLLIGTQPRVEAAMVNARICKTVRASNAKV
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT




BSS

TT


SSGGGGS
SS
TTGGGG
SS

TTTSSSS

 .........430.........440.........450.........460.........470.........480.........490
Sequence GYVGPPAEFNYDCKHLGTGPDTLKEIAEGRHPFCTALKNAKNPAIIVGAGLFNRTDKNAILSSVESIAQA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) SS



SS


SSSTT
STT
SSB
GGGGSSTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence NNVVRPDWNGLNFLLQYAAQAAALDLGLIQQSAKALESAKFVYLMGADDVNVDKIPKDAFVVYQGHHGDK
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) T
S
TTT




SSTT




SSSSSS
S

BS
SSS
TTTS
SSS



SS
SS
 .........570.........580.........590.........600.........610.........620.........630
Sequence AVYRANVILPASAFTEKEGTYENTEGFTQQTVPAVPTVGDARDDWKIVRALSEVSGVKLPYNSIEGVRSR
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
S

B

TTTS

B


TTS


B



S

STT
B
TT


S

S
 .........640.........650.........660.........670.........680.........690...
Sequence IKSVAPNLVHTDEREPAAFGPSLKPECKEAMSTTPFQTVVENFYMTNSITRASKIMAQCSAVL
Predicted secondary structure




































SS confidence






























































Known secondary structure (DSSP)
GGGTSTT







GGGS






SSS



S
S
SSSSSS
TTTTT
STT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D