Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6zxyB_

Fold library idPDB HeaderMoleculeTitle
c6zxyB_2.75PDB header: rna binding proteinChain: B: PDB Molecule: trna (guanine(10)-n2)-dimethyltransferase;


Added to library: Sat Sep 26 08:41:08 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MGRGSMKFLFYLSADNLEIARKEVLVLAERYGWVEDYQFEERLLLLDYAGEKFFERLAYTNEVTKIYDIC
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)





TT
TT


GGG
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence SVSELEQVFSEIPVYDRLCCVRVKGGKGKTALERKLGALLWKRGAKVSVSNPEIVYKVYIQDDKCYVGLL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
STTS


SS
S
SSSTTT

B
SSS
SSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence EFERDTRQFFLRRPDRRPFLMPSAIKPKLARALVNLTGVLEGETLLDPMCGTGSFLIEAGLMGINPIGID
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)

SSGGGSSS

TT


TT

TTSTT
TT
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence FIEKIVRGCRVNLEYYGIEGSVLLGDAKNLPLRDESVRGIATDYPYLRGTLDELYSKTSEEFERVLKKGG
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) S
TT



BTTB
SS
TT

STT


 .........290.........300.........310.........320.
Sequence RAAIVTNIDVESFFSNFEIEMKTEERVHGSLTRRIYLLRRH
Predicted secondary structure








SS confidence








































Known secondary structure (DSSP) SS

GGGGTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D