Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6zwmE_

Fold library idPDB HeaderMoleculeTitle
c6zwmE_3.20PDB header: transferaseChain: E: PDB Molecule: rapamycin-insensitive companion of mtor;


Added to library: Sat Nov 21 08:45:39 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLN
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)





S
GGGSS

S


SS
TTTTTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence EAKEVRAAGLRALRYLIQDSSILQKVLKLKVDYLIARCIDIQQSNEVERTQALRLVRKMITVNASLFPSS
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S


STTS

SS
SS
STT

 .........150.........160.........170.........180.........190.........200.........210
Sequence VTNSLIAVGNDGLQERDRMVRACIAIICELALQNPEVVALRGGLNTILKNVIDCQLSRINEALITTILHL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) SSTTTT
TT
TT
SSTT

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence LNHPKTRQYVRADVELERILAPYTDFHYRHSPDTAEGQLKEDREARFLASKMGIIATFRSWAGIINLCKP
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTSTTS
SSSSGGGTT
SS



SS

TT
STSSS
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence GNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVTEEFIEALLSVDPGRFQDSWRLSDGFVAAEAK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SS
TTTTTS

TTTT




S
SST
TT


GGGSTTTTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence TILPHRARSRPDLMDNYLALILSAFIRNGLLEGLVEVITNSDDHISVRATILLGELLHMANTILPHSHSH
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) S

S
SS


TTSS
S
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence HLHCLPTLMNMAASFDIPKEKRLRASAALNCLKRFHEMKKRGPKPYSLHLDHIIQKAIATHQKRDQILKD
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SSTT
T
SSS




SS





 .........500.........510.........520.........530.........540.........550.........560
Sequence TEEALLINLRDSQVLQHKENLEWNWNLIGTILKWPNVNLRNYKDEQLHRFVRRLLYFYKPSSKLYANLDL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
STSTTT


TT
S
STT
SSSS



TTTTSGGGSBS
 .........570.........580.........590.........600.........610.........620.........630
Sequence DFAKAKQLTVVGCQFTEFLLESEEDGQGYLEDLVKDIVQWLNASSGMKPERSLQNNGLLTTLSQHYFLFI
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) S
TTSTTT
TTT
STTT
SSS



TTBGGGG
 .........640.........650.........660.........670.........680.........690.........700
Sequence GTLSCHPHGVKMLEKCSVFQCLLNLCSLKNQDHLLKLTVSSLDYSRDGLARVILSKILTAATDACRLYAT
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) SSTTTTT
SS

TTS

SSSSSS
 .........710.........720.........730.........740.........750.........760.........770
Sequence KHLRVLLRANVEFFNNWGIELLVTQLHDKNKTISSEALDILDEACEDKANLHALIQMKPALSHLGDKGLL
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTSTT
TTT
S
TTSS



SSS
 .........780.........790.........800.........810.........820.........830.........840
Sequence LLLRFLSIPKGFSYLNERGYVAKQLEKWHREYNSKYVDLIEEQLNEALTTYRKPQRPHVYLPIHLYGQLV
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) GGGGSTT
TTT














T
 .........850.........860.........870.........880.........890.........900.........910
Sequence HHKTGCHLLEVQNIITELCRNVRTPDLDKWEEIKKLKASLWALGNIGSSNWGLNLLQEENVIPDILKLAK
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTSSTTT
S


SSTTSTTT
 .........920.........930.........940.........950.........960.........970.........980
Sequence QCEVLSIRGTCVYVLGLIAKTKQGCDILKCHNWDAVRHSRKHLWPVVPDYIGLALPVDINDIFQVKDIPY
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
SSTTSSTT



SS
SS








SSGGGTT






 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence FQTKSFHLLRQQMSLTEIMNTGLQEHTDDNCLYCVCIEILGFQPSNQLSMCRILLRKEVLRLVINLSSSV
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP) SS


TTTS




SS

STTSTTTT









TTTTS
S
 .........1060.........1070.........1080.........1090.........1100.........1110.......
Sequence STKCHETGLLTIKEKYPQTFDDICLYSEVSHLLSHCTFRLPCRRFIQELFQDVQFLQMHEEAEAVLA
Predicted secondary structure











SS confidence


































































Known secondary structure (DSSP) S
TTTT

TSS


TSS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D