Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6zgpG_

Fold library idPDB HeaderMoleculeTitle
c6zgpG_2.01PDB header: oxidoreductaseChain: G: PDB Molecule: carnitine monooxygenase oxygenase subunit;


Added to library: Sat Nov 21 08:39:53 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AVEKLPEDFCANPDVAWTFPKVFYTSSQVFEHEKEAIFAKSWICVAHGSELAQPNDYITRKVIGENIVII
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)





TTTTSSTTS
B


GGGGT
TTTTS
GGGG
STTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence RGKDSVLRAFYNVCPHRGHELLSGSGKAKNVITCPYHAWTFKLDGSLALARNCDHVESFDKENSSMVPLK
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)
TTS
SS
TTT





SS

S
TTT

TTS
B


TTGGGSTT

STTSS

 .........150.........160.........170.........180.........190.........200.........210
Sequence VEEYAGFVFINMDENATCVEDQLPGFAERLNQACGVIKDLKLAARFVTETPANWKVIVDNYMECYHCGPA
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TTS
TT


STT
TTGGG
SS
T

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence HPGFADSVQVDKYWHTTHQNWTLQYGFARSSEKSFTDPEFHGFWTWPCTMFNVPPGSNFMTVIYEFPVDA
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
STTTTTS
TTS
SS


SSS




TTT
TTSS
T
 .........290.........300.........310.........320.........330.........340.........350
Sequence ETTLQHYDIYFTNEELTQDQKDLIEWYRNVFRPEDLNLVESVQRGLKSRGYRGQGRIMTDKQRSGISEHG
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TS
SS

TTTSTTS
S

B



TT

TT

 .........360...
Sequence IAYFQHLVAQYHQ
Predicted secondary structure
SS confidence












Known secondary structure (DSSP) TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D