Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6yxaA_

Fold library idPDB HeaderMoleculeTitle
c6yxaA_3.95PDB header: signaling proteinChain: A: PDB Molecule: gtp pyrophosphokinase;


Added to library: Sat Sep 26 08:42:58 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ANEQVLTAEQVIDKARSYLSDEHIAFVEKAYLYAEDAHREQYRKSGEPYIIHPIQVAGILVDLEMDPSTI
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)






TTS
STT


TTS

STTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence AGGFLHDVVEDTDVTLDDLKEAFSEEVAMLVDGVTKLGKIKYKSQEEQQAENHRKMFVAMAQDIRVILIK
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TTTSTTTSS

T
S



SS
SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LADRLHNMRTLKHLPQEKQRRISNETLEIFAPLAHRLGISKIKWELEDTALRYLNPQQYYRIVNLMKKKR
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP) T
TTS
TTTB
 .........220.........230.........240.........250.........260.........270.........280
Sequence AERELYVDEVVNEVKKRVEEVNIKADFSGRPKHIYSIYRKMVLQNKQFNEIYDLLAVRILVNSIKDCYAV
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) GGGT







STT

STT
S

S
SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence LGIIHTCWKPMPGRFKDYIAMPKPNMYQSLHTTVIGPKGDPLEVQIRTFEMHEIAEYGVAAHWEGATFEK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) S
TTTS

TTS




SSSS




SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence KLSWFREILEFQNESTDAEEFMESLDLFSDMVYVFTPKGDVIELPSGSVPIDFSYRIHSEIGNKTIGAKV
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T
S










TTS
TT


T
 .........430.........440.........450.........460.........470.........480.........490
Sequence NGKMVTLDHKLRTGDIVEILTSKHSYGPSQDWVKLAQTSQAKHKIRQFFKKQRREENVEKGRELVEKEIK
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TT
TT



SS
B
SSS



TT


SS
 .........500.........510.........520.........530......
Sequence NLDFELKDVLTPENIQKVADKFNFSNEEDMYAAVGYNGITALQVAN
Predicted secondary structure


















SS confidence













































Known secondary structure (DSSP) TTTT


STT

S
GGGT

S



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D