Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6yirA_

Fold library idPDB HeaderMoleculeTitle
c6yirA_1.68PDB header: hydrolaseChain: A: PDB Molecule: oligosaccharides import atp-binding protein msmx;


Added to library: Sat Nov 21 10:08:17 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AELRMEHIYKFYDQKEPAVDDFNLHIADKEFIVFVGPSGCGASTTLRMVAGLEEISKGDFYIEGKRVNDV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)



SSSS
S
TT

STTSSTSS

STT
TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence APKDRDIAMVFQNYALYPHMTVYDNIAFGLKLRKMPKPEIKKRVEEAAKILGLEEYLHRKPKALSGGQRQ
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
GGGTTTTTT



TTS
TT

TT
GGGTTS
GGGS
 .........150.........160.........170.........180.........190.........200.........210
Sequence RVALGRAIVRDAKVFLMDEPLSNLDAKLRVQMRAEIIKLHQRLQTTTIYVTHDQTEALTMATRIVVMKDG
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TT
SSTTTTS


S

STT
 .........220.........230.........240.........250.........260.........270.........280
Sequence KIQQIGTPKDVYEFPENVFVGGFIGSPAMNFFKGKLTDGLIKIGSAALTVPEGKMKVLREKGYIGKEVIF
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
S
SBSSSS


SSTT

TT
TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence GIRPEDIHDELIVVESYKNSSIKAKINVAELLGSEIMIYSQIDNQDFIARIDARLDIQSGDELTVAFDMN
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
GGGTTT
SS

SS

STTTT

SS

TTS
GG
 .........360......
Sequence KGHFFDSETEVRIRLE
Predicted secondary structure







SS confidence















Known secondary structure (DSSP) G
TTT
BB




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D