Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ygaB_

Fold library idPDB HeaderMoleculeTitle
c6ygaB_2.40PDB header: transferaseChain: B: PDB Molecule: n-alpha-acetyltransferase 35, natc auxiliary subunit;


Added to library: Sat Oct 31 08:32:53 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PXEVDSILGSLSITDDFDQLVDVTSLFDELCSKLKPEAIVKDPRFDLFEGTHSLEVNNSKLDSSLIELTA
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

STTTSSTTSS




S
TT




SS

GGGGGG


TT
TTT
GGG



 .........80.........90.........100.........110.........120.........130.........140
Sequence EEIEFDVNVAYDPPLASVAAIADRLLRCVISWLNDYQTLPTTVLSCRYTESLLSSLVKGSSWCTGNILYD
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

TTS

SSTS


STTTGGGB





S
 .........150.........160.........170.........180.........190.........200.........210
Sequence KVLGSCILGVCYLTKFVQKLLSAGIVFEEEDLNFNNXGFNTFDNLPGQDVVINSLTESLQILEAYSDDSL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TTT
S
BTTTB



TT


TT
S



S

 .........220.........230.........240.........250.........260.........270.........280
Sequence HLTXLKHILKIIICLVHLEDHLTDYSTKTSHLDELIENANSVNGIFPQLQLSPPKGAFSTYIQKHRSNQF
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) GGGT




GGG





TTSB
SS


S
 .........290.........300.........310.........320.........330.........340.........350
Sequence PPRKITKLPTDYSGFITLANDVKTILLVDKAESALETYQFAKFFNKLEQRHVIARILFPLFFIRDDRTVL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)








SSSGGGG

STTTSS


B
TTS
BT
 .........360.........370.........380.........390.........400.........410.........420
Sequence GKFSYTQFYLLHVKEFSAQTPSGNELIQESSNXLLEWYQNCSQNTCRYRQGFNRQLILWDSLQAQFESVN
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) TTB







TS
TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence SQVYCSWTYFXKLSSXIEFSLKGFDLDIYKPFEAYSXFWYVYYLSHHLETFLKDSQNDIESNINAIHSXN
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
TT
S
GGG
 .........500.........510.........520.........530.........540.........550.........560
Sequence KKLKKLKAGEKKDQLRLKYRFAXDNEXEQLQATKQFLNYLLKEINITKSLCLIEVFQFAILKSFGLIDNK
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

SSTTTS

SS
 .........570.........580.........590.........600.........610.........620.........630
Sequence NSTPSKFSNERLIHNLRFKPFNSIGVPELPEYEVFQQTLKDFVIEEKGAAFDIKLERATNFIETEVRNVV
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
SS

SS

TGGGTT
TTTT


S



 .........640.........650.........660.........670.........680.........690.........700
Sequence SSIDEIXQGIKGGDNNGVLVTGTRLVQELSLEYYCKLKHTSKALSVNSKVIVNTLKKNIKNKDSHEYKVE
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
S
SSS




GGG
SS


 .........710.........
Sequence LVHTTEGWNYFPIQTLRIK
Predicted secondary structure







SS confidence


















Known secondary structure (DSSP)

TTS
TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D