Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6yesB_

Fold library idPDB HeaderMoleculeTitle
c6yesB_4.10PDB header: dna binding proteinChain: B: PDB Molecule: cas10d;


Added to library: Sat Oct 31 08:30:26 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LIGLVRTALDSITLGQGVNEAKIKSPQSYAFHTISVGTISLDICKAIYSSSEIGRKQLENLSKKYNMPFE
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)

SBSB

SSS

B
T

 .........80.........90.........100.........110.........120.........130.........140
Sequence DLWFYGGFLHDWNKLSGKEENKEELTKKIIDKLKLPNEFLHGISTMAEGHLPDNLHLPLWVSIKLADMLL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TTS



GGGT

SSS
SSGGGT
 .........150.........160.........170.........180.........190.........200.........210
Sequence ISDIGSVRDVFYFANSDSYRNAIEALKEYNLELNYVSSTFRLFTLIASKELLNDVFNEKSGYFPLISYAD
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) SS


SSTTTTT



TTS
GGGT




SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence GIVFLKRKNSQPVLLSKIVDLLSRQVFSSSSEVIEEKISDIEKCIKNKEELFRQMNIDVKSAIYDEEGKV
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TT



BSTTTTTTT
SSSTTTTTSSTB
SSSSB
 .........290.........300.........310.........320.........330.........340.........350
Sequence KQINAFLPTKVCKPFEDVVGNLDNKSKLQVAREVIERNRKDIPFGLLIYFVNKFSKNEEDYIRKGLGINE
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

S
TTT



SS

STTTTGGGTTTTTSSTTSS
S
SS




SS

S
SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence KSLKYLLNIGDVQKALDKILELLEKRYAEQSSDKTLLYYVKFSSSGNIIDDLPKITDRVCPICIYEANLM
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TS

GGGTTTTTTT

TTSSSTTS
SBSSB




S





TTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence KDRVKPPYFIVTFYPGVPISLLNIIDFDFSQSSIKYYIDEEKDTYFTAFEKMGGRLEPYVKKVLPAYFSS
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTTT
S

SS
TT

TTT
S




SSSSBTT
SS

S
GGGT
 .........500.........510.........520.........530.........540.........550.........560
Sequence KVIIKASEVSNFSLSTRLSKSELNKLLPYAPMISMIFLTSPVLISSNLYEMPIAHERVISITSTYNYTFM
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

S


SS

GGGTSS

SSTT






SS


SS

GGG
 .........570.........580.........590.........600.........610.........620.........630
Sequence KSLNSNLLTLYSIFAYSAKYDAMRKICGRSDLDNCLGYLTEEMDLYSSVDPALGVLSIGMGVGTPIDTDE
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)


SSS
TT




SSSS


 .........640.........650.........660.........670.........680.........690.........700
Sequence KFFSAFLPVSGYLLKVTGKVSKMGETLKSSIFSIAYALKDIIKSQKVSKYDVTGFLRDGVDMFFKTTSVI
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TTTTTTS



S


TTTTTT
T
 .........710.........720.........730.........740.........750.........760.........770
Sequence KDKEDRIGISVNAAISSLENKYALDDQHRAQVYSALQDIFKTLYSIEEESDRSLAISIANTLSNWLYIAY
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) S
S


SS
 ......
Sequence KLVLQG
Predicted secondary structure

SS confidence





Known secondary structure (DSSP) T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D