Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6y9gB_

Fold library idPDB HeaderMoleculeTitle
c6y9gB_1.75PDB header: hydrolaseChain: B: PDB Molecule: ancestral haloalkane dehalogenase anchld5;


Added to library: Sat Nov 21 10:44:51 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PFERRHVEVLGSTMHYVETGEGPPVLFLHGNPTSSYLWRNIIPHVADHGRCIAPDLIGMGQSGKPDIDYR
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

TT

SS

TT

GGGGTTTTTTS

TTSTTS


SS


 .........80.........90.........100.........110.........120.........130.........140
Sequence FADHVRYLDAFIDALGLDDVTLVVHDWGSALGFHWARRHPDRVKGIAFMEAIVRPMPSWDDFPPQARELF
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) T

SSGGG

S
BSSGGGS
GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence QALRTPGVGEKMILEQNMFIEKILPGSVLRPLSEEEMDAYRAPFPTPESRKPVLQWPRELPIDGEPADVV
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TSTTTTT
TTSSS


TT

STGGGS
BTTBS
 .........220.........230.........240.........250.........260.........270.........280
Sequence AIVEAYAEWLATSDVPKLLFYAEPGALISPEQVEWCRENLPNLEVVHVGPGLHFLQEDQPDAIGQAIADW
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)




SSS

TT
S
GGGT
 .....
Sequence LQRLA
Predicted secondary structure
SS confidence




Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D