Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6y88B_

Fold library idPDB HeaderMoleculeTitle
c6y88B_2.10PDB header: lyaseChain: B: PDB Molecule: indole-3-glycerol phosphate synthase;


Added to library: Sat Sep 26 08:34:28 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SVPTVLQKILARKAEEVAERRARVNLAEVERLARSADAPRGFANALLERAKRKEPAVIAEIKKASPSKGV
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


S
TS




TTT


STTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LREHFVPAEIARSYEAGGAACLSVLTDVDFFQGADAYLKEARAACALPVIRKDFMIDPYQIVEARAIGAD
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

SS

T
S

STTT


TSSS
S


STT
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence CILLIVSALDDVLMAELAATAKSVGLDVLVEVHDGTELERALKTLDTPLVGINNRNLHTFEVSLETTLDL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) GGG

TT
SS


S
B
TTT

B
T
 .........220.........230.........240.........250.........260.....
Sequence LPEIPRDRLVVTESGILNRADVELMEVSEVYAFLVGEAFMRADDPGLELKRLFFQ
Predicted secondary structure



















SS confidence






















































Known secondary structure (DSSP) GGGS
TTSS


STT


TSSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D