Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6xxqA_

Fold library idPDB HeaderMoleculeTitle
c6xxqA_3.00PDB header: transferaseChain: A: PDB Molecule: streptomycin 3''-adenylyltransferase;


Added to library: Sat Apr 18 08:25:12 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NTYEQINKVKKILRKHLKNNLIGTYMFGSGVESGLKPNSDLDFLVVVSEPLTDQSKEILIQKIRPISKKI
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
GGGGGGTSS


TT
SS


GGGS

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence GDKSNLRYIELTIIIQQEMVPWNHPPKQEFIYGEWLQELYEQGYIPQKELNSDLTIMLYQAKRKNKRIYG
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) T


S

SGGGSS

SS


GGGTTT



S
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence NYDLEELLPDIPFSDVRRAIMDSSEELIDNYQDDETNSILTLCRMILTMDTGKIIPKDIAGNAVAESSPL
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) SS
S



TT
TT

S


TTS
 .........220.........230.........240........
Sequence EHRERILLAVRSYLGENIEWTNENVNLTINYLNNRLKK
Predicted secondary structure









SS confidence





































Known secondary structure (DSSP) TT




TTS
T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D