Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6xsuB_

Fold library idPDB HeaderMoleculeTitle
c6xsuB_1.41PDB header: hydrolaseChain: B: PDB Molecule: gh5-4 broad specificity endoglucanase;


Added to library: Sat Nov 21 08:46:17 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ASNMTASQITQEMKIGWNLGNTLDAYGGTAKGVATETSWGNPKTTKAMIDAVKAKGFNTVRIPTTWFPHL
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)





STTSTT

SSS

GGGGGGTTS




T





GGGB
 .........80.........90.........100.........110.........120.........130.........140
Sequence DGSNNIDSAWMARVKEVVDYCIDNDMYVILNLHHEEWVDRPDLGSAYNEMQPKFTKIWSQIADAFKDYDQ
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
TT

B
TTT


S
TTTS
TTGGG
TTT

T
 .........150.........160.........170.........180.........190.........200.........210
Sequence HLIFESMNEPRAKGTDHEWWGPQQSEVDTINKLNQDFVKLIRSSGSANNKNRLLMIPGYCASADQTMFSK
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TS
SS


TTSTTSSS


SS



GGG

STT
 .........220.........230.........240.........250.........260.........270.........280
Sequence IQVPSDNMVAISIHAYVPYDFTMNTAVSDHSTFSTKYSSSLNQTLESIRNTFTSKGIPVVIGEFGTSNFG
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)



S
TT


ST
TTSS





TGGGT





SS
 .........290.........300.........310.........320.........330.........340........
Sequence NTEARVKWAEQYMRTTKEMGIPCVLWDNNVINAPSSAGECHGYLNRSNLTWYTESEPVVNKMMEVLGV
Predicted secondary structure






























SS confidence



































































Known secondary structure (DSSP)
T


S



GGGGGG



TTTT
TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D