Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6xsoA_

Fold library idPDB HeaderMoleculeTitle
c6xsoA_1.50PDB header: hydrolaseChain: A: PDB Molecule: cellulase;


Added to library: Sat Nov 21 08:40:12 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HHHHHENLYFQSFETATNAVKNMGVGWNLGNTLDANDATKTWTTTVQHETCWGQPVTKPELFKMMKEAGF
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

GGGG








T

TTSTT


TT


SSTTTS




TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GAIRVPVTWYQEMDANGKVNEAWMKRVKEVVDYVVAQDMYCIINVHHDTGADKDAFKSWIKADEANYNQN
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)




GGGB
TT

B
TTT



TTSS

BTTB

S

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence KAKYEYLWRQIAEAFKDYGDKVLFESYNEMLDKLNSWCFASFAASGQYDATVATSAYNAINGYARSFVNA
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT

TTS
S



TT


SSTTTTSGGG

 .........220.........230.........240.........250.........260.........270.........280
Sequence VRGTGGNNVRRNLIVNTYAAANGSGNWNAHLKDPLSKLVIPQGERDHIAVQVHAYPTIAGKTISAIRTDT
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) T
GGGGT


GGG




SSSTTTTT



TT
SSS



TT

 .........290.........300.........310.........320.........330.........340.........350
Sequence RDLMNGLNTYFVSKGIPVIIGEWSTSNVDAKETDYDARKSLMFQFVDDFVAQAKALGIATFYWMGLSDGA
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TGGGT



TTTTSSS
STT
S
SS
GG
 .........360.........370...
Sequence SRTMPSFNQADLAERIAKAYHGV
Predicted secondary structure











SS confidence






















Known secondary structure (DSSP) GGGTT

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D