Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6xrsB_

Fold library idPDB HeaderMoleculeTitle
c6xrsB_2.80PDB header: hydrolaseChain: B: PDB Molecule: gtpase der;


Added to library: Sat Sep 26 09:02:41 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IMKPTIALIGRPNVGKSTLFNRLTRTKDALVHDLPGLTRDRHYGHGKVGSKPYFVIDTGGFEHEMAKQTL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)




STTSST

SS





TT




S

SSSS

GGGT




 .........80.........90.........100.........110.........120.........130.........140
Sequence QAVDEADAVVFLVDGRTGLTPQDKIIADRLRQSPRPVYLAVNKGEGGDRAVLAAEFYELALGEPHVISGA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) SSTTT


T
SS
S
SSS
GGG
S
S


TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence HGDGVYYLIEEILENFPEADAKHPVFAVIGRPNVGKSTLVNAILGEKRVIAIHIDFEREGKPFTIIDTFS
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) T
TTTSS




SS

STTSSTSTT

TT



 .........220.........230.........240.........250.........260.........270.........280
Sequence VIKAMQAVEAANVAVLVLDAQQDIADQDATIAGFALEAGRALVVAVNKWDGISEERREQVKRDISRKLYF
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
STTS


TT

GGGS
TGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence LDFAKFHFISALKERGIDGLFESIQAAYNAAMIKMPTPKITRVLQTAVGRQQPPLVRPKMRYAHQGGMNP
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) GTTS
BTTTTBST



S






TTT
 .........360.........370.........380.........390..
Sequence PVIVVHGNSLHAISDSYTRYLTQTFRKAFNLQGTPLRIQYNV
Predicted secondary structure














SS confidence









































Known secondary structure (DSSP) TS
SS

T
TTS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D