Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6xr5F_

Fold library idPDB HeaderMoleculeTitle
c6xr5F_1.70PDB header: lyaseChain: F: PDB Molecule: diphosphomevalonate decarboxylase;


Added to library: Sat Sep 26 08:42:24 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MVHEATASAPVNIACIKYWGKRDTRLILPTNSSLSVTLDQDHLRSTTTSRADASFEAGDRLWLNGREEAI
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)







TTTTSS
B
TTTS

TTS
SS
TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence KEGGRLAVCIKELRAWRKEMETKDKNLPKLSEWPLRIASYNNFPTAAGLASSASGLAALVASLASLYSLP
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
TTS
TTS

GGGS



TTS



TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence QSPSQLSLVARQGSGSACRSLFGGFVAWREGTDPAGSDSLAEEVAPREHWPEMHALICVVSDAKKGTGMQ
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

GGGGGGGSSS


S
TT
TT


GGGSTT

TT



 .........220.........230.........240.........250.........260.........270.........280
Sequence KTVETSTLLQERLRVVPKRMDAISQAIKARDFAEFAKLTMADSNSFHAVCLDTAPPIFYLNDVSRAIIAV
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)
T
TSSS





 .........290.........300.........310.........320.........330.........340.........350
Sequence VEELNRAAGEIIAAYTFDAGPNAVIYTLEKNMPFVLGAIKRFFPTESPFQTGVRDLPEGFNTGVVREGGW
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TS


SSS
GGGS



SS







TT

GGGS
TT

 .........360.........370.........380.......
Sequence EKGAVKGLIHTRVGDGPRVLEKEDSLLGENGVPKVLA
Predicted secondary structure

























SS confidence




































Known secondary structure (DSSP)
TTSB

S


GGG
SB
TTSSBSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D