Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6xmsA_

Fold library idPDB HeaderMoleculeTitle
c6xmsA_3.40PDB header: transport proteinChain: A: PDB Molecule: p5a-type atpase;


Added to library: Sat Sep 26 09:32:00 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KSFVSSPIVRDSTLLVPKSLIAKPYVLPFFPLYATFAQLYFEWTFVYLGTLVSLNILVMLMPAWNVKIKA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

SSS
B

GGGSTTTSTT


SGGGT
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence KFNYSTTKNVNEATHILIYTTPNNGSDGIVEIQRVTEAGSLQTFFQFQKKRFLWHENEQVFSSPKFLVDE
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TB

B

TTT


TTSS



B

TT

BTT
TTTT



TTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence SPKIGDFQKCKGHSGDLTHLKRLYGENSFDIPIPTFMELFKEHAVAPLFVFQVFCVALWLLDEFWYYSLF
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)

B




S



SS






TTSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence NLFMIISMEAAAVFQRLTALKEFRTMGIKPYTINVFRNKKWVALQTNELLPMDLVSITRTAEESAIPCDL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) GGGS




TT
SSS

SS

S

TT


SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence ILLDGSAIVNEAMLSGESTPLLKESIKLRPSEDNLQLDGVDKIAVLHGGTKALQVTPPEHKSDIPPPPDG
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) S



S


B

STTS
SSS
B

SSGGGGS
TT


SS

SS


SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence GALAIVTKTGFETSQGSLVRVMIYSAERVSVDNKEALMFILFLLIFAVIASWYVWVEGTKMGRIQSKLIL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)

GGGSTS


SS


TT

STTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence DCILIITSVVPPELPMELTMAVNSSLAALAKFYVYCTEPFRIPFAGRIDVCCFDKTGTLTGEDLVFEGLA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

TTSTTTTTS
GGGTGGGTS


TBTTTB
S

 .........500.........510.........520.........530.........540.........550.........560
Sequence GISADSENIRHLYSAAEAPESTILVIGAAHALVKLEDGDIVGDPMEKATLKAVGWAVERKNSNYREGTGK
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) S

SS


SS

SS
S
S



TTS
S
T

B
SSS
B

SSS

 .........570.........580.........590.........600.........610.........620.........630
Sequence LDIIRRFQFSSALKRSASIASHNDALFAAVKGAPETIRERLSDIPKNYDEIYKSFTRSGSRVLALASKSL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)




STT

SS

TT
S


TTSSS

 .........640.........650.........660.........670.........680.........690.........700
Sequence PKDLNRDDVESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVFGETLI
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)




TSS


B
TTTT


S
TS

S

 .........710.........720.........730.........740.........750.........760.........770
Sequence LDRAGKSDDNQLLFRDVEETVSIPFDPSKDTFDHSKLFDRYDIAVTGYALNALEGHSQLRDLLRHTWVYA
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) SSS

S

SSTT


SSS





TTT
TTTTT

 .........780.........790.........800.........810.........820.........830.........840
Sequence RVSPSQKEFLLNTLKDMGYQTLMCGDGTNDVGALKQAHVGIALLNGTEEGLKKLGEQRRLEALKLGDASC
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) S

TT




SSTTSS
B







GGGS
S
 .........850.........860.........870.........880.........890.........900.........910
Sequence AAPFTSKLANVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYMAGVKFGDGQATVSGLLLSV
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) SSS
SS
TTSS



S
 .........920.........930.........940.........950.........960.........970.........980
Sequence CFLSISRGKPLEKLSKQRPQSGIFNVYIMGSILSQFAVHIATLVYITTEIYKLEPREPQVDLEKEFAPSL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T


B
SS

S

B


SSSS




SS







 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence LNTGIFIIQLVQQVSTFAVNYQGEPFRENIRSNKGMYYGLLGVTGLALASATEFLPELNEAMKFVPMTDD
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) S


TTTB

TTT
TS
TT




 .........1060.........1070.........1080.........1090.
Sequence FKIKLTLTLLLDFFGSWGVEHFFKFFFMDDKPSDISVQQVK
Predicted secondary structure









SS confidence








































Known secondary structure (DSSP) SB



SS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D