Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6xk1B_

Fold library idPDB HeaderMoleculeTitle
c6xk1B_1.70PDB header: hydrolaseChain: B: PDB Molecule: biuret hydrolase;


Added to library: Sat Nov 21 08:38:37 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MIYSTVNANPYAWPYDGSIDPAHTALILIDWQIDFCGPGGYVDSMGYDLSLTRSGLEPTARVLAAARDTG
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)

B

B

BSSSBSTTS
B
GGG

BSTTSTT

TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence MTVIHTREGHRPDLADLPPNKRWRSASAGAEIGSVGPCGRILVRGEPGWEIVPEVAPREGEPIIDKPGKG
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP)

B
TT
TT

TT

TTSTTTTBTTSGGGSB
GGG


TTS
SSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence AFYATDLDLLLRTRGITHLILTGITTDVSVHTTMREANDRGYECLILSDCTGATDRKHHEAALSMVTMQG
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SSTTSSTT


TTTT

SSTGGG
 .........220.......
Sequence GVFGATAHSDDLLAALG
Predicted secondary structure


SS confidence
















Known secondary structure (DSSP) TTT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D