Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6wy9A_

Fold library idPDB HeaderMoleculeTitle
c6wy9A_2.00PDB header: oxidoreductaseChain: A: PDB Molecule: acyl-coa dehydrogenase domain protein tcur3483;


Added to library: Sat Oct 31 08:59:49 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EPAALSELRAELRAYFNGLLPADERRRVGEQGVGGERFREVVKMLGSDGWLGYGWPKEYGGQGRSISEQY
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TT

SGGGSTTTT
TTTTS
GGGT




 .........80.........90.........100.........110.........120.........130.........140
Sequence VLFDEVQRAGLPFPFVTVNTVGPTLMKYGTEEQKKKYLPGILSGDIVFAIGYTEPGAGTDLASLTTRAVR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) T



T

TT




BTTBSS
GGG


 .........150.........160.........170.........180.........190.........200.........210
Sequence DGDEFVIDGSKIFTSGANTADYIWLACRTDPEAPKHKGISIIIVPTDAEGFSWSPIQTVGGMVVTATYYS
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) SSS

TTTTT
S

TTS
GGGSTTSTT
TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence GVRVPVSEVVGEINGGWKLITTQLNHERIGLAALGGRMIRLWEDVVAWARDNGVLEQPWVRRDLARTYAK
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) GGGSSTTBTTSGGGS
 .........290.........300.........310.........320.........330.........340.........350
Sequence LEAMRLLNWKMTIAVENDELTGADAGATKAYGTETHIDVQRTLTGILGAAGRIRPESPGAVLAGQIEQLS
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) T


TGGGGG

TTSTT
SGGG
 .........360.........370.........380
Sequence RQGIVNTFAGGVNEVLRDMVATLGLGMPRS
Predicted secondary structure













SS confidence





























Known secondary structure (DSSP) TTTTS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D