Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6wvkD_

Fold library idPDB HeaderMoleculeTitle
c6wvkD_3.36PDB header: transcriptionChain: D: PDB Molecule: dna-directed rna polymerase subunit beta';


Added to library: Sat Nov 21 08:57:51 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VNNFEYMNIGLASPDKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECHCGKYKRVRYKGV
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)

S












TTTT
TTSTT


SSSS

TTSS


TTSS
B
 .........80.........90.........100.........110.........120.........130.........140
Sequence VCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPANTP
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

TTT


B

S

TTT

SSSTTSS

TTTS



SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LEKKQLLSEKEYRAYLDKYGNKFQASMGAEAIHKLLQDIDLVKEVDMLKEELKTSQGQRRTRAIKRLEVL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)

TT
B

GGGS
S

TTT

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence EAFRNSGNKPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQN
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) T


GGGG

GGGS




TTS







 .........290.........300.........310.........320.........330.........340.........350
Sequence EKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPHLKMY
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
SSSSS


B
TTS
B


TT
SS
TTTTTTS



SS
TTS
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence QCGLPKEMALELFKPFVMKELVEKGLAHNIKSAKRKIERVQPEVWDVLESVIKEHPVLLNRAPTLHRLGI
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) STTT
SSTT
TTSSSS


SS

SGGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence QAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQ
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SSSS
GGGGTTTT

TTT



STSBGGG

B
TTT

BS



T
 .........500.........510.........520.........530.........540.........550.........560
Sequence DMVLGNYYLTLERAGAVGEGMVFKNTDEALLAYQNGYVHLHTRVAVAANSLKNVTFTEEQRSKLLITTVG
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)


SS
TTTT
SSSTS

TT
TTSSS
S


TSTT
 .........570.........580.........590.........600.........610.........620.........630
Sequence KLVFNEILPESFPYMNEPTKSNIEEKTPDRFFLEKGADVKAVIAQQPINAPFKKGILGKIIAEIFKRFHI
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TTSS
TTS



SSSTT


STT
SS

TTTS






S
 .........640.........650.........660.........670.........680.........690.........700
Sequence TETSKMLDRMKNLGFKYSTKAGITVGVSDIVVLDDKQEILEEAQSKVDNVMKQFRRGLITEEERYERVIS
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) T



TTTS


TTTSS
 .........710.........720.........730.........740.........750.........760.........770
Sequence IWSAAKDVIQGKLMKSLDELNPIYMMSDSGARGNASNFTQLAGMRGLMANPAGRIIELPIKSSFREGLTV
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S
TT
TTSS

T

B

TTT
SS
B


TTT


 .........780.........790.........800.........810.........820.........830.........840
Sequence LEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIIRETDCGTDRGILAKPLKEGTETIERLEERL
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TT
S



STT


SS
S

S







BTTB
S

S
 .........850.........860.........870.........880.........890.........900.........910
Sequence IGRFARKQVKHPETGEVLVNENELIDEDKALEIVEAGIEEVWIRSAFTCNTPHGVCKRCYGRNLATGSDV
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TT
BBSS



TTT


SS
TT
B

TT




GGG


SS
B
TTTSSB
 .........920.........930.........940.........950.........960.........970.........980
Sequence EVGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGDDITQGLPRIQELFEARNPKGQATITEIDGTVVEINE
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
TT



TTSGGGS
SS

STTT


SSB

B
SS

 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence VRDKQQEIVVQGAVETRSYTAPYNSRLKVAEGDKITRGQVLTEGSIDPKELLKVTDLTTVQEYLLHEVQK
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) SSSS
SS
TT

B


SS

SS
B
BSSB

S
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence VYRMQGVEIGDKHVEVMVRQMLRKVRVIDAGDTDVLPGTLLDIHQFTEANKKVLLEGNRPATGRPVLLGI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T



GGGG
SS

TTT

TT
TTTTSS
SSS




 .........1130.........1140.........1150.........1160.........1170.........1180....
Sequence TKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTGMMKYRKVKPVS
Predicted secondary structure
































SS confidence































































Known secondary structure (DSSP) TT

S
STTTTTTS
T


ST


SSGGGST





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D