Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6wvkC_

Fold library idPDB HeaderMoleculeTitle
c6wvkC_3.36PDB header: transcriptionChain: C: PDB Molecule: dna-directed rna polymerase subunit beta;


Added to library: Sat Nov 21 08:51:44 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TGQLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGLREMFQDISPIEDFTGNLSLEFIDYSL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


SSS



S


S



TTTTTTTS


BSTTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence GEPKYPVEESKERDVTYSAPLRVKVRLINKETGEVKDQDVFMGDFPIMTDTGTFIINGAERVIVSQLVRS
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)


SS
TT



TTS







TTS
TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence PSVYFSGKVDKNGKKGFTATVIPNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFGSDQEILDLI
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) S


SSS



SBS


TTS
TTB


BTS


T
 .........220.........230.........240.........250.........260.........270.........280
Sequence GENEYLRNTLDKDNTENSDKALLEIYERLRPGEPPTVENAKSLLDSRFFDPKRYDLANVGRYKINKKLHI
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) T

TT



S

SS




SSTTTTSSTTS
B


S
 .........290.........300.........310.........320.........330.........340.........350
Sequence KNRLFNQRLAETLVDRRTLDKVLPYLENGIGFRKLYPNGGVVEDEVTLQSIKIFAPTDQEGEQVINVIGN
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TT

B


B


B


SS
S



S



S





SSS






SS

TT

 .........360.........370.........380.........390.........400.........410.........420
Sequence AYIEEEIKNITPADIISSISYFFNLLHGVGDTDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMS
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)



TT

S

TTT
S



SSSSSS
TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence IQDTNTITPQQLINIRPVIASIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGEVRDVHYSHYGRMCPI
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) T


SS





SS


SSTSS







GGGTTTB
SS
 .........500.........510.........520.........530.........540.........550.........560
Sequence ETPEGPNIGLINSLSSYAKVNRFGFIETPYRRVDPETGKVTGRIDYLTADEEDNYVVAQANARLDDEGAF
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


SSSSSSSB
SS

SSS

TTT
STTTGGGS

TT

B
SSS
B
 .........570.........580.........590.........600.........610.........620.........630
Sequence IDDSIVARFRGENTVVSRNRVDYMDVSPKQVVSAATACIPFLENDDSNRALMGANMQRQAVPLMQPEAPF
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SSSSSS
TTS


S
GGGSS
SSGGG
SSGGGB
B


SS



S
 .........640.........650.........660.........670.........680.........690.........700
Sequence VGTGMEYVSGKDSGAAVICKHPGIVERVEAKNVWVRRYEEVDGQKVKGNLDKYSLLKFVRSNQGTCYNQR
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)
SS
S
SS
TTGGGGS
SS







S
TTSB

 .........710.........720.........730.........740.........750.........760.........770
Sequence PIVSVGDEVVKGEILADGPSMELGELALGRNVMVGFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEYES
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)


TT

TT

TTTT

S


TTTTTTSSTTTT
 .........780.........790.........800.........810.........820.........830.........840
Sequence EARDTKLGPEEITRDIPNVGEDALRNLDDRGIIRIGAEVKDGDLLVGKVTPVRDTSLRVPHGGGGIIHDV
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) B
SSSB
B

S

SS

SSSSSSB
TTSBB
SS

TT




TT

 .........850.........860.........870.........880.........890.........900.........910
Sequence KVFNREDGDELPPGVNQLVRVYIVQKRKISEGDKMAGRHGNKGVISKILPEEDMPYLPDGTPIDIMLNPL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) GGGT



TT


TT
TT
TTTS
B
TTS
B
S
ST
 .........920.........930.........940.........950.........960.........970.........980
Sequence GVPSRMNIGQVLELHMGMAARYLGIHIASPVFDGAREEDVWETLEEAGMSRDAKTVLYDGRTGEPFDNRV
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TTTTTTBT



TTSS

T

SSS
B

B
SSS

B
SS
B
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence SVGIMYMIKLAHMVDDKLHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
BS

GGGT



SS

B
SSS

B

TTTT






ST
TTT
 .........1060.........1070.........1080.........1090.........
Sequence DDVVGRVKTYEAIVKGDNVPEPGVPESFKVLIKELQSLGMDVKILSGDE
Predicted secondary structure






















SS confidence
















































Known secondary structure (DSSP) S
T








TTS





SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D