Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6wqyA_

Fold library idPDB HeaderMoleculeTitle
c6wqyA_1.05PDB header: hydrolaseChain: A: PDB Molecule: cellulase;


Added to library: Sat Nov 21 08:43:49 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HHHHHENLYFQSVSGETPLEIAVSLGLGWNLGNQLDAHNNGVADETSWGNAAATQALFDALANAGFTSVR
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)








S




SS
S
SSTT
TT
TTSSS




T

 .........80.........90.........100.........110.........120.........130.........140
Sequence IPVTWLGHVGEAPDYTIDETYLNRVAEVVGYAESAGLNAIINIHHDGANSQYWLDIKDAATDETVNSAVK
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)



TTSB

TTT

B
TT


GGGGGG
SSS
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence AQLAAMWTQIANRFADKGNFLVFEAMNEIHDGSWGWGDNRTDGGRQYAVLNEWNQVFVDAVRATGGNNQT
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTT

TT

S


SSSTTSSGGGTSTTT
GGGGS
 .........220.........230.........240.........250.........260.........270.........280
Sequence RYLGVPGYVTNIDLTVENFVLPQDVVDNRLMVAVHFYDPIDYTENADNIYSQWGHTADPSLKADWGDEDN
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)


GGG






SSSS


SST
TTS




STTS
GGGS
SS
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence VTGQFAKMKETFIDQGIPAYIGEMGCVHRADDLSESFRLYYLEYVCKAAKDYGMPPFYWDAGGDGTGTQS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TGGGT






SSTT



S
S
SSS
 .........360.........370.........
Sequence WALFNHATGEMLNNAQEVIDVMKRGIFTV
Predicted secondary structure










SS confidence




























Known secondary structure (DSSP)

SB
TTT

B
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D