Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6wqpB_

Fold library idPDB HeaderMoleculeTitle
c6wqpB_1.60PDB header: hydrolaseChain: B: PDB Molecule: endoglucanase;


Added to library: Sat Nov 21 08:37:49 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLELLEPPTQMRDLTASQLLDEITIGWNLGNTLDATTTSWLPNPTPAQSETAWGCPMTTKAMIDKVKEGG
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)



SS


S







TTSTT


TTT
SS

TTTS




TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence FNTVRVPVSWIDHTGSAPEYQIDEAWMNRVQEVVNYVIDNDMYCILNIHHENDWLIPTNAQKDSVNARLD
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)





GGGB
STTT

B
TTT


S
TTT


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence AIWTQIATRFGSYDEHLIFEGMNQPRLVGDPNEWNGGNQEARQVINSYNQTFVNTVRATGGNNAIRCLMV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTT

TT

S



TTSTTTTTT

T
GGGGT

 .........220.........230.........240.........250.........260.........270.........280
Sequence PTYAASCSSTTVNDFVLPTDTVANKLIVDIHSYSPYNFALNTSGTSSFTQSDISQLQWTLQEIYNSFGAK
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
GGG

ST





SSSS



ST
TTS




GGGTGGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence GIPVIIGQFGALNKNNINGRVLWGENYLRIAKSYNIRCIWWDNNAFDTSGENFGLLNRGTLTWQYPELLE
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) T





SS
TT


S
SSSSS




TTTTS
 ....
Sequence AMMK
Predicted secondary structure
SS confidence



Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D