Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6wm6A_

Fold library idPDB HeaderMoleculeTitle
c6wm6A_1.42PDB header: peptide binding proteinChain: A: PDB Molecule: extracellular solute-binding protein, family 5;


Added to library: Sat Nov 21 09:17:55 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VTGELITTVNSGTPGKGGEVTFAVTRDITNWNVTSALGNNAVVRTVTLPIVPSAFMVQPDFTLKMNTDLL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

S

TTTTT




S

SS

S


TTBTTT
STTTS

S
TTS

TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence ESAELTSTDPQTVVYRIREDAVWSDGVPITGDDFIYFWKTQNRRDCPECLINASYGHDFIETLEQDETGK
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TT
TT
B
TTS
B

SSSS
TT

BS

TTGGG
TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence VVTATFSEPFLGWQGLFMFLYPAHLAEKHGDIAESYNNFLSNEVPAWSGGPYMVESFDPGQLVTLVPNPK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SS

TTGGGTTSS


TTSSSTS




SSSTTT
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence WYGEKGPYLDKLKFRIITDSTQQLTALENGEVDVIYPQGATQDMVEQAAGLDYLGIDFQMNPSANWYFMG
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

SSS



S
S
GGGTTS
S

SS

TGGGT

 .........290.........300.........310.........320.........330.........340.........350
Sequence LNSKAGPMSDIALRKAVLTAIDAGDLKAKTADPYLRNWPHMGSVMFLPNQAGYADRRGARGYGTGDVEKA
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)

SSSGGGS
BTTTTSTT

B


SS

TTSTT


TTTTB

 .........360.........370.........380.........390.........400.........410.........420
Sequence KGILSEAGYKLSGGSLLDPSGKPVSTLRLSFPPGYPAANDMARLITGYIAPLGLKTDLLTGPNATADYLL
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT
TT
TTS
B




SS
GGGT


SGGGSGGG

 .........430.........440.........450.........460.........470.........480.........490
Sequence SGNFDLHLNYFSQQVFPAVKAGQIFLRDTRQNYFGFNDPKIEEIIGKAAAASSIEESAAILSEADELAMD
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTT
S

SSSSTT
TT

S



T
SS
 .........500.........510.........520.........530......
Sequence YAALFPIYQLPTALIYKEAILNLRDNPNQLGPAYNTAEWGLAELEH
Predicted secondary structure





















SS confidence













































Known secondary structure (DSSP) TS

TTS




SSS
GGGGGGG






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D