Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6whaA_

Fold library idPDB HeaderMoleculeTitle
c6whaA_3.36PDB header: membrane protein/immune systemChain: A: PDB Molecule: soluble cytochrome b562,5-hydroxytryptamine receptor 2a


Added to library: Sat Sep 26 09:34:14 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VIILTIAGNILVIMAVLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYGYRWPSKLCAVWIYLDVLFST
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)




SSTTS



 .........80.........90.........100.........110.........120.........130.........140
Sequence ASIMHLCAISLDRYVAIQNPIHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKGSCLLAD
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
SS

S
S









 .........150.........160.........170.........180.........190.........200.........210
Sequence DNFVLIGSFVSFFIPLTIMVITYFLTIKSLQISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVNEDVIG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) SST




 .........220.........230.........240....
Sequence ALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSR
Predicted secondary structure



SS confidence

































Known secondary structure (DSSP) SSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D