Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6wfmA_

Fold library idPDB HeaderMoleculeTitle
c6wfmA_1.95PDB header: transferaseChain: A: PDB Molecule: udp-n-acetylglucosamine 1-carboxyvinyltransferase;


Added to library: Sat Apr 18 08:31:52 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HMAKIVVTGGAALHGEVSISGAKNAVLPILCATLLADEPVEITNVPHLHDVVTTVKLLGELGAKVTIDQG
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)







B
GGGBSS



TT


 .........80.........90.........100.........110.........120.........130.........140
Sequence TLSRGSAIVVDPRPVNQHVAPYELVKTMRASILVLGPLLARFGAAEVSLPGPVDQHIKGLQALGAEIVVE
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) BTTB

TT



B

TT
GGGGGGS




TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence NGFIKASAKRLKGGHFTFDMVSVTGTENVLMGAVLAEGTTVLDNCAMEPEVTDLAHCLIALGAKIEGLGT
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT
SS
B


SS

TTSBSS



TT

TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence ARLVIEGVERLSGGRHEVLPDRIETGTFLVAAAMTGGKVTVNRARPNTMDAVLSKLVEAGAKIETTDDSI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) S


S
B



B
TT
S

GGG
TT

SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence TLDMQGRRPKAVNLTTAPYPAFPTDMQAQFMALNCVADGVGVINETIFENRFMHVNELLRLGADIQVEGH
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TT


B




STTS

GGGTSBS

S
SS

TTTT
TT
 .........360.........370.........380.........390.........400.........410.......
Sequence TAIVRGSEHLSGAPVMATDLRASASLILAGLMASGDTTIDRIYHLDRGYENIEEKLSSLGATIRRVP
Predicted secondary structure




























SS confidence


































































Known secondary structure (DSSP)

S

B


STTSBSGGG

GGGSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D