Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6wc0A_

Fold library idPDB HeaderMoleculeTitle
c6wc0A_3.61PDB header: rna binding protein/rna/dnaChain: A: PDB Molecule: crispr-associated endonuclease, csn1 family;


Added to library: Sat Nov 21 09:05:11 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GTVPVTWRLGVDVGERSIGLAAVSYEEDKPKEILAAVSWIHDGGVGDERSGASRLALRGMARRARRLRRF
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)






SSTT

TTBS
SSTT
B
 .........80.........90.........100.........110.........120.........130.........140
Sequence RRARLRDLDMLLSELGWTPLPDKNVSPVDAWLARKRLAEEYVVDETERRRLLGYAVSHMARHRGWRNPWT
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT




SSSS
TT




S

B

TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence TIKDLKNLPQPSDSWERTRESLEARYSVSLEPGTVGQWAGYLLQRAPGIRLNPTQQSLSNATAFETRLRQ
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
TS
SS




SS

STT

SS









S
SS

B
 .........220.........230.........240.........250.........260.........270.........280
Sequence EDVLWELRCIADVQGLPEDVVSNVIDAVFCQKRPSVPAERIGRDPLDPSQLRASRACLEFQEYRIVAAVA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) T

T




B

TTSS
B
SS
TTSBTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence NLRIRDGSGSRPLSLEERNAVIEALLAQTERSLTWSDIALEILKLPNESDLTSVPEEDGPSSLAYSQFAP
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) T

SS




SSS

BTT

S
GGG
SSTT





SSSB

 .........360.........370.........380.........390.........400.........410.........420
Sequence FDETSARIAEFIAKNRRKIPTFAQWWQEQDRTSRSDLVAALADNSIAGHLPDAELEALEGLALPSGRVAY
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)


TTTS

SSB



TGGGGS



S
 .........430.........440.........450.........460.........470.........480.........490
Sequence SRLTLSGLTRVMRDDGVDVHNARKTCFGVDDNWRPPLPALHEATGHPVVDRNLAILRKFLSSATMRWGPP
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) S


SS

SS






TTS

S
S


 .........500.........510.........520.........530.........540.........550.........560
Sequence QSIVVELGSAGGYAAVALRDRLLSYGEKNGVAQVAVFRGGVTAEARRWLDISIERLFSRVAIFAQSTSTK
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S

TT
SSSTTTT

TT



BSS



T
 .........570.........580.........590.........600.........610.........620.........630
Sequence RLDRRHHAVDAVVLTTLTPGVAKTLADARSRRVSASTEEPQSPAYRQWKESCSGLGDLLISTAARDSIAV
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTBTTTT









TTTT

 .........640.........650.........660.........670.........680.........690.........700
Sequence AAPLRLRPTGALHEETLRAFSEHTVGAAWKGAELRRIVEPEVYAAFLALTDPGGRFLKVSPSEDVLPADE
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)




S

S

B
S

B

SSS
TB
S
TT
SS



SSS


T
 .........710.........720.........730.........740.........750.........760.........770
Sequence NRHIVLSDRVLGPRDRVKLFPDDRGSIRVRGGAAYIASFHHARVFRWGSSHSPSFALLRVSLADLAVAGL
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) T

B

SS

B
TT

SSSS
TTB
S
SSSTT
 .........780.........790.........800.........810.........820.........830.........840
Sequence LRDGVDVFTAELPPWTPAWRYASIALVKAVESGDAKQVGWLVPGDELDFGPEGVTTAAGDLSMFLKYFPE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
STT

SSSS


TTSTS
TT


TT

TTT


S

TS

 .........850.........860.........870.........880.........890.........900.........910
Sequence RHWVVTGFEDDKRINLKPAFLSAEQAEVLRTERSDRPDTLTEAGEILAQFFPRCWRATVAKVLCHPGLTV
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
TTSSB
STT
B
TTT
T

TT
 .........920.........930........
Sequence IRRTALGQPRWRRGHLPYSWRPWSADPW
Predicted secondary structure



















SS confidence



























Known secondary structure (DSSP)
B
TTS
B

S

SS


B
TTT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D