Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6w7xA_

Fold library idPDB HeaderMoleculeTitle
c6w7xA_1.90PDB header: transferaseChain: A: PDB Molecule: acetylornithine aminotransferase;


Added to library: Sat Apr 18 08:46:04 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LISLSHYYPRQVVLERGQGARVWDSQGREFIDLAAGIAVCGLGHNDPDLVAALVEQAGKLWHTSNVFYSA
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
GGGGG



S

BTTT

SST
TT
BS
TT
S


TTS

 .........80.........90.........100.........110.........120.........130.........140
Sequence PPLHLAEELVKASRFAERVFLCNSGAEANEVAIKMVRKWASSQGRPADKRVIITFRGSFHGGGFRYIDFN
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TS
SS
TT

GGG
TTT





TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence DEVQLETAMAAGDVAAVMLEPIQGEGGVMPAKSGFLKRVRELCDQHDALLVLDEIQAGMGRTGTLFAHWQ
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TTS

STTTTS

TTTT

TTTTTTTTSSSSGGGT
 .........220.........230.........240.........250.........260.........270.........280
Sequence DDVVPDMVTLAKALGGGFPIGAMLAGPKVAETGGNPLAAAVARVALRKLASSEIAANVSRQSKALRDGFA
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TT


S
GGGGTTSS

T



TS
 .........290.........300.........310.........320.........330.........340.........350
Sequence RINEEFGVFSEVRGRGLMLGAVLSKDFAGQAGAILDHAAGQGLLTLQAGPDVLRFVPSLNITDEEVAEGL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

TT
GGGTT
TT
SSTT


TT

 .........360....
Sequence KRLRAAIAAFIAAR
Predicted secondary structure


SS confidence













Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D